Loading...
Statistics
Advertisement

Valley Vogue Collections
www.valleyvogue.com/
Unique handwovens, handspun and hand dyed, and shrinkart, shaped and painted to coordinate or enhance wearable art.

Valleyvogue.com

Advertisement
Conversion Technology Metas Server
Valleyvogue.com is hosted in United States / New York . Valleyvogue.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 2. First javascripts: XK4fVpkTATBcue6...rG_xl39.js, Site.js, Number of used analytics tools: 0. Its server type is: . Its CMS is: Squarespace.

Technologies in use by Valleyvogue.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • Lightbox
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • xK4fVpkTATBcue6puDb1HtOcod6pe7eHJp80TeIuNmJfel9ffFHN4UJLFRbh52jhWD9hjDwo5eIXw2BqjcB8ZRFKZe9ojRw3ZsT1iaiaO1ZydeU8pWZzZam8OcFzdPUhjAUCZW8hdhiuZPoRdhXCdeNRjAUGdaFXOeFyZhB0OWFuShB0O1FUiABkZWF3jAF8OcFzdP37OcFyZhB0OWFuShB0O1FUiABkZWF3jAF8OcFzdPJwSY4zpe8ljPu0daZyH6qJ73IbMg6gJMJ7fbKCMsMMeMC6MKG4f5J7IMMjMkMfH6qJtkGbMg6FJMJ7fbKzMsMMeMb6MKG4fOMgIMMj2KMfH6GJCwbgIMMjgPMfH6GJCSbgIMMj2kMfH6qJnbIbMg6eJMJ7fbK0MsMMegM6MKG4fJCgIMMjgkMfH6qJRMIbMg6sJMJ7fbKTMsMMeM66MKG4fHGgIMMjIKMfH6qJKbIbMg64JMJ7fbKHMsMMegw6MTMgrG_xl39.js
  • site.js

Content Management System

Number of occurences: 1
  • Squarespace

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Valleyvogue.com

SSL certificate

    • name: /C=US/ST=New York/L=New York/O=Squarespace, Inc./OU=Web Services/CN=*.squarespace.com
    • subject:
      • C: US
      • ST: New York
      • L: New York
      • O: Squarespace, Inc.
      • OU: Web Services
      • CN: *.squarespace.com
    • hash: 0420e8ec
    • issuer:
      • C: US
      • O: DigiCert Inc
      • OU: www.digicert.com
      • CN: DigiCert SHA2 High Assurance Server CA
    • version: 2
    • serialNumber: 5424579060044022025581262814810671247
    • validFrom: 140409000000Z
    • validTo: 170612120000Z
    • validFrom_time_t: 1397001600
    • validTo_time_t: 1497268800
    • extensions:
      • authorityKeyIdentifier: keyid:51:68:FF:90:AF:02:07:75:3C:CC:D9:65:64:62:A2:12:B8:59:72:3B
      • subjectKeyIdentifier: 66:00:FC:DC:5D:A9:05:68:C4:F7:7A:45:5B:F0:B0:72:B9:F6:E1:E6
      • subjectAltName: DNS:*.squarespace.com, DNS:squarespace.com
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl3.digicert.com/sha2-ha-server-g1.crl Full Name: URI:http://crl4.digicert.com/sha2-ha-server-g1.crl
      • certificatePolicies: Policy: 2.16.840.1.114412.1.1 CPS: https://www.digicert.com/CPS
      • authorityInfoAccess: OCSP - URI:http://ocsp.digicert.com CA Issuers - URI:http://cacerts.digicert.com/DigiCertSHA2HighAssuranceServerCA.crt
      • basicConstraints: CA:FALSE

Meta - Valleyvogue.com

Number of occurences: 7
  • Name:
    Content: Unique handwovens, handspun and hand dyed, and shrinkart, shaped and painted to coordinate or enhance wearable art.
  • Name: viewport
    Content: width=device-width,initial-scale=1
  • Name: twitter:title
    Content: home
  • Name: twitter:url
    Content: http://www.valleyvogue.com/
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: Unique handwovens, handspun and hand dyed, and shrinkart, shaped and painted to coordinate or enhance wearable art.
  • Name: description
    Content: Unique handwovens, handspun and hand dyed, and shrinkart, shaped and painted to coordinate or enhance wearable art.

Server / Hosting

  • IP: 198.49.23.145
  • Latitude: 40.72
  • Longitude: -74.01
  • Country: United States
  • City: New York

Rname

  • ns43.domaincontrol.com
  • ns44.domaincontrol.com
  • smtp.secureserver.net
  • mailstore1.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Fri, 06 May 2016 19:12:35 GMT X-ServedBy: web040 Location: http://www.valleyvogue.com/ X-ContextId: BOFxlrbH/rOG8RxgL X-Via: 1.1 echo015 X-Cache: MISS from s_xt13 X-Cache-Lookup: MISS from s_xt13:80 Via: 1.1 s_xt13 (squid/3.5.13) Connection: keep-alive HTTP/1.1 200 OK Date: Fri, 06 May 2016 19:12:36 GMT X-ServedBy: web039 Set-Cookie: crumb=ARnIDOvSQfGhsJ5ORFoF3-tNE0OfwVde;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Set-Cookie: SS_MID=e68748df-f1c7-476b-80bf-39cfaa648143inw3mjxd;Path=/;Domain=.valleyvogue.com;Expires=Mon, 04-May-2026 19:12:36 GMT Accept-Ranges: bytes Content-Type: text/html; charset=UTF-8 X-PC-AppVer: 7720 X-PC-Date: Fri, 06 May 2016 19:12:32 GMT X-PC-Host: 10.100.101.128 ETag: W/"77163751d69cc4d81268e0315567109a" X-PC-Key: FLZOx-O88c7TdkYGRA5bZD737dk-cagan-susan X-PC-Hit: true X-ContextId: qnkuBH0l/MQPnYBQZ X-Via: 1.1 echo007 X-Cache: MISS from s_xt13 X-Cache-Lookup: MISS from s_xt13:80 Via: 1.1 s_xt13 (squid/3.5.13) Connection: keep-alive

DNS

host: valleyvogue.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 198.49.23.145
host: valleyvogue.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 198.185.159.144
host: valleyvogue.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 198.185.159.145
host: valleyvogue.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 198.49.23.144
host: valleyvogue.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns43.domaincontrol.com
host: valleyvogue.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns44.domaincontrol.com
host: valleyvogue.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns43.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050300
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: valleyvogue.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net
host: valleyvogue.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.alleyvogue.com, www.vyalleyvogue.com, www.yalleyvogue.com, www.vzalleyvogue.com, www.zalleyvogue.com, www.vhalleyvogue.com, www.halleyvogue.com, www.vnalleyvogue.com, www.nalleyvogue.com, www.vmalleyvogue.com, www.malleyvogue.com, www.vjalleyvogue.com, www.jalleyvogue.com, www.vkalleyvogue.com, www.kalleyvogue.com, www.vialleyvogue.com, www.ialleyvogue.com, www.vlleyvogue.com, www.vaolleyvogue.com, www.volleyvogue.com, www.vaplleyvogue.com, www.vplleyvogue.com, www.va9lleyvogue.com, www.v9lleyvogue.com, www.valleyvogue.com, www.vlleyvogue.com, www.vailleyvogue.com, www.villeyvogue.com, www.vaulleyvogue.com, www.vulleyvogue.com, www.valeyvogue.com, www.valuleyvogue.com, www.vauleyvogue.com, www.val8leyvogue.com, www.va8leyvogue.com, www.val9leyvogue.com, www.va9leyvogue.com, www.valjleyvogue.com, www.vajleyvogue.com, www.val0leyvogue.com, www.va0leyvogue.com, www.valmleyvogue.com, www.vamleyvogue.com, www.valpleyvogue.com, www.vapleyvogue.com, www.valoleyvogue.com, www.vaoleyvogue.com, www.valeyvogue.com, www.vallueyvogue.com, www.valueyvogue.com, www.vall8eyvogue.com, www.val8eyvogue.com, www.vall9eyvogue.com, www.val9eyvogue.com, www.valljeyvogue.com, www.valjeyvogue.com, www.vall0eyvogue.com, www.val0eyvogue.com, www.vallmeyvogue.com, www.valmeyvogue.com, www.vallpeyvogue.com, www.valpeyvogue.com, www.valloeyvogue.com, www.valoeyvogue.com, www.vallyvogue.com, www.vallexyvogue.com, www.vallxyvogue.com, www.vallesyvogue.com, www.vallsyvogue.com, www.vallewyvogue.com, www.vallwyvogue.com, www.valleryvogue.com, www.vallryvogue.com, www.vallefyvogue.com, www.vallfyvogue.com, www.vallevyvogue.com, www.vallvyvogue.com, www.vallecyvogue.com, www.vallcyvogue.com, www.valleqyvogue.com, www.vallqyvogue.com, www.valleayvogue.com, www.vallayvogue.com, www.valleyyvogue.com, www.vallyyvogue.com, www.vallevogue.com, www.valleyzvogue.com, www.vallezvogue.com, www.valleyavogue.com, www.valleavogue.com, www.valleysvogue.com, www.vallesvogue.com, www.valleydvogue.com, www.valledvogue.com, www.valleyvogue.com, www.vallevogue.com, www.valleycvogue.com, www.vallecvogue.com, www.valley vogue.com, www.valle vogue.com, www.valleyogue.com, www.valleyvyogue.com, www.valleyyogue.com, www.valleyvzogue.com, www.valleyzogue.com, www.valleyvhogue.com, www.valleyhogue.com, www.valleyvnogue.com, www.valleynogue.com, www.valleyvmogue.com, www.valleymogue.com, www.valleyvjogue.com, www.valleyjogue.com, www.valleyvkogue.com, www.valleykogue.com, www.valleyviogue.com, www.valleyiogue.com, www.valleyvgue.com, www.valleyvobgue.com, www.valleyvbgue.com, www.valleyvohgue.com, www.valleyvhgue.com, www.valleyvoggue.com, www.valleyvggue.com, www.valleyvojgue.com, www.valleyvjgue.com, www.valleyvomgue.com, www.valleyvmgue.com, www.valleyvo gue.com, www.valleyv gue.com, www.valleyvovgue.com, www.valleyvvgue.com, www.valleyvoue.com, www.valleyvogsue.com, www.valleyvosue.com, www.valleyvogxue.com, www.valleyvoxue.com, www.valleyvogyue.com, www.valleyvoyue.com, www.valleyvoghue.com, www.valleyvohue.com, www.valleyvognue.com, www.valleyvonue.com, www.valleyvogcue.com, www.valleyvocue.com, www.valleyvogdue.com, www.valleyvodue.com, www.valleyvogeue.com, www.valleyvoeue.com, www.valleyvogrue.com, www.valleyvorue.com, www.valleyvogtue.com, www.valleyvotue.com, www.valleyvogbue.com, www.valleyvobue.com, www.valleyvogvue.com, www.valleyvovue.com, www.valleyvoge.com, www.valleyvoguwe.com, www.valleyvogwe.com, www.valleyvoguee.com, www.valleyvogee.com, www.valleyvoguse.com, www.valleyvogse.com, www.valleyvoguae.com, www.valleyvogae.com,

Other websites we recently analyzed

  1. Ãœber uns | cairos-academy
    Germany - 78.47.220.105
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  2. miscmannamagalginknimatnyasvetchargapoleaz
    San Francisco (United States) - 192.0.78.13
    Server software: nginx
    Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
    Number of Javascript: 8
    Number of meta tags: 7
  3. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
    Kansas City (United States) - 173.208.215.148
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  4. Restaurant La Ripaille
    Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
    France - 213.186.33.104
    G Analytics ID: UA-441859-8
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 4
  5. Tennessee Career Centers
    Columbia (United States) - 66.211.30.3
    G Analytics ID: UA-39861102-1
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
    Number of Javascript: 4
    Number of meta tags: 1
  6. Home | Instant Spark
    Scottsdale (United States) - 173.201.243.1
    Server software: Apache
    Technology: Html
  7. Die Potsdam Lions
    Germany - 212.90.148.98
    Server software: Apache/2.2.31
    Technology: Html, Php
    Number of meta tags: 1
  8. Dorcas Clothing :: Wholesale Clothing
    Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
    Montréal (Canada) - 184.107.203.99
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
    Number of Javascript: 10
    Number of meta tags: 10
  9. THE NEW MILLIONS
    New York (United States) - 198.185.159.145
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  10. ماشین های اداری امیران
    امیران ماشین
    Iran, Islamic Republic of - 185.8.172.176
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 3

Check Other Websites